Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Picea sitchensis CASP-like protein 4

This Recombinant Picea sitchensis CASP-like protein 4 spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

CASP-like protein 4

UniProt

D5A8E6

Expression Region

1-226

Origin

Picea sitchensis (Sitka spruce) (Pinus sitchensis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRKHIDIVFSRLSGPILNPPPDNNVIPKTDRKLRITEVILRFAVVIFALVSAIMVGTASG TRDLGGGIRIHAHFTLLKTLPFLVIVDGILAVYSLLQGLRCFLSLYMRHILLNKALAWTI FCCDQALAYVIFAAAASTAETAYISEQGLDELQWIKVCMFFRAYCFKSGAGMINAFLAAL CMVFVSGMSVFHLFRLYGEKRAYGHIAEQVVISEEAAERRNSLNGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage Scavenger Receptor I (MSR1) (NM_002445) Human Recombinant Protein
TP312931M 100 µg

Macrophage Scavenger Receptor I (MSR1) (NM_002445) Human Recombinant Protein

Sign In for Pricing
View Details
PHYHD1 (NM_001100877) Human Over-expression Lysate
LC420301 20 µg

PHYHD1 (NM_001100877) Human Over-expression Lysate

Sign In for Pricing
View Details
Optitrol ToRCH M
SR13027 2x 2.5 mL

Optitrol ToRCH M

Sign In for Pricing
View Details
Human HIVEP3 activation kit by CRISPRa
GA111812 1 Kit

Human HIVEP3 activation kit by CRISPRa

Sign In for Pricing
View Details
Z-PHE-ONP
TRC-P399365-500MG 500 mg

Z-PHE-ONP

Sign In for Pricing
View Details
Tropomyosin 3 (TPM3) (NM_001043351) Human Over-expression Lysate
LC420816 20 µg

Tropomyosin 3 (TPM3) (NM_001043351) Human Over-expression Lysate

Sign In for Pricing
View Details