Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Picea sitchensis CASP-like protein 4

This Recombinant Picea sitchensis CASP-like protein 4 spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

CASP-like protein 4

UniProt

D5A8E6

Expression Region

1-226

Origin

Picea sitchensis (Sitka spruce) (Pinus sitchensis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRKHIDIVFSRLSGPILNPPPDNNVIPKTDRKLRITEVILRFAVVIFALVSAIMVGTASG TRDLGGGIRIHAHFTLLKTLPFLVIVDGILAVYSLLQGLRCFLSLYMRHILLNKALAWTI FCCDQALAYVIFAAAASTAETAYISEQGLDELQWIKVCMFFRAYCFKSGAGMINAFLAAL CMVFVSGMSVFHLFRLYGEKRAYGHIAEQVVISEEAAERRNSLNGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bax (2D2), CF405S conjugate, 0.1mg/mL
BNC040004-100 1x 100 µL

Bax (2D2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ku80 (XRCC5) Rabbit Polyclonal Antibody
AP01251PU-N 100 µg

Ku80 (XRCC5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
One-step TUNEL Flow Cytometry Apoptosis Kit (Blue, Elab Fluor® Violet 450)
E-CK-A423-01 20 Assays

One-step TUNEL Flow Cytometry Apoptosis Kit (Blue, Elab Fluor® Violet 450)

Sign In for Pricing
View Details
One-step TUNEL Flow Cytometry Apoptosis Kit (Blue, Elab Fluor® Violet 450)
E-CK-A423-02 100 Assays

One-step TUNEL Flow Cytometry Apoptosis Kit (Blue, Elab Fluor® Violet 450)

Sign In for Pricing
View Details
Human PCT Antibody Pair Set
E-KAB-0135 50 µL & 100 µg

Human PCT Antibody Pair Set

Sign In for Pricing
View Details
Calcitroic Acid
TRC-C144550-5MG 5 mg

Calcitroic Acid

Sign In for Pricing
View Details