Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 204 (Tmem204)

This Recombinant Mouse Transmembrane protein 204 (Tmem204) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Transmembrane protein 204, Claudin-like protein 24

UniProt

Q7TQI0

Expression Region

1-226

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLQKLVATAVLVALVSLILNNAAAFTPNWVYQTLEDGRKRSVGLWKSCWLVDRGKGVTS PGTRTGQVDTHDCEVLGWGSESAGFQESRGTVKLQFDMMRACNLVATAALVVGQITFILG LTGLPLMSPESQCWEEAMAAAFQLASFVLVIGLVTFYRIGPYTNLSWSCYLNIGACLLAT LAAAMLIWNILHRREDCMAPRVIVISRSLTARFRRGLDNDYVESPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPG21 Polyclonal Antibody, Biotin Conjugated
bs-11785R-Biotin 100 µL

SPG21 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Chicken Centromere protein O (CENPO) ELISA Kit
MBS7221793-01 48 Well

Chicken Centromere protein O (CENPO) ELISA Kit

Sign In for Pricing
View Details
Chicken Centromere protein O (CENPO) ELISA Kit
MBS7221793-02 96 Well

Chicken Centromere protein O (CENPO) ELISA Kit

Sign In for Pricing
View Details
Chicken Centromere protein O (CENPO) ELISA Kit
MBS7221793-03 5x 96 Well

Chicken Centromere protein O (CENPO) ELISA Kit

Sign In for Pricing
View Details
Chicken Centromere protein O (CENPO) ELISA Kit
MBS7221793-04 10x 96 Well

Chicken Centromere protein O (CENPO) ELISA Kit

Sign In for Pricing
View Details
SCARNA3 AAV siRNA Pooled Vector
43120161 1.0 µg

SCARNA3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details