Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aedes aegypti ATP synthase subunit a (mt:ATPase6)

This Recombinant Aedes aegypti ATP synthase subunit a (mt:ATPase6) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

Q1HRS5

Expression Region

1-226

Origin

Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMTNLFSVFDPSTTILNLSLNWLSTFLGLLIIPSTYWLMPNRFQIIWNNILLTLHKEFKT LLGPNGHNGSTLMFVSLFSLIMFNNFLGLFPYIFTSTSHLTLTLTLAFPLWLSFMLYGWI CHTQHMFAHLVPQGTPPVLMPFMVCIETISNVIRPGTLAVRLTANMIAGHLLMTLLGNTG PMSTSYIILSLILITQIALLVLESAVAIIQSYVFAVLSTLYSSEVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-100 1x 100 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-100 1x 100 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (HCGb/54), CF740 conjugate, 0.1mg/mL
BNC740054-100 1x 100 µL

HCG-beta (HCGb/54), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (rCDH1/1525), CF568 conjugate, 0.1mg/mL
BNC682067-100 1x 100 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (rCDH1/1525), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (GM022), CF488A conjugate, 0.1mg/mL
BNC880874-100 1x 100 µL

PLAP (Placental Alkaline Phosphatase) (GM022), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details