Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Lysosomal-associated transmembrane protein 4B (LAPTM4B)

This Recombinant Bovine Lysosomal-associated transmembrane protein 4B (LAPTM4B) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Lysosomal-associated transmembrane protein 4B

UniProt

Q71SV0

Expression Region

1-226

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKMVAPWTRFYSNSCCLCCHVRTGTILLGVWYLILNAVVLLILLSALADPDHYHFSSSEL GGDFEFMDDANMCIAIAISVLMILICAMATYGAYKQRAAWIIPFFCYQIFDFALNTLVAV TVLVYPNSIQEYIRQLPPDFPYKDDIMSVNPTCLVLIILLFISIILAFKGYLISCVWNCY RYINGRNSSDVLVYVTSNDSTVLLPPYDDATVNSATKEPPPPYVSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF568 conjugate, 0.1mg/mL
BNC680861-100 1x 100 µL

HSP27 (G3.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
BNC680669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-100 1x 100 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-100 1x 100 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-100 1x 100 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF488A conjugate, 0.1mg/mL
BNC882040-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details