Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus Gap junction beta-2 protein (GJB2)

This Recombinant Pongo pygmaeus Gap junction beta-2 protein (GJB2) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Gap junction beta-2 protein, Connexin-26, Cx26

UniProt

Q8MIT9

Expression Region

1-226

Origin

Pongo pygmaeus (Bornean orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDWGALQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGC KNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEE IKTQKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDGFSMQRLVKCNAWPCPNTVDC FVSRPTEKTVFTVFMIAVSGICILLNVTELCYLLIRYCSGRSKKPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-D Butyl Ester
TRC-D826515-250MG 250 mg

2,4-D Butyl Ester

Sign In for Pricing
View Details
Cycloxygenase-2 (COX-2) (COX2/3232R), Biotin conjugate, 0.1mg/mL
BNCB3232-100 1x 100 µL

Cycloxygenase-2 (COX-2) (COX2/3232R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATP6V1C2 (NM_144583) Human Recombinant Protein
TP760121 50 µg

ATP6V1C2 (NM_144583) Human Recombinant Protein

Sign In for Pricing
View Details
ICOS Ligand (ICOSLG) (NM_015259) Human Recombinant Protein
TP720398XL 1 mg

ICOS Ligand (ICOSLG) (NM_015259) Human Recombinant Protein

Sign In for Pricing
View Details
Human SOX1 activation kit by CRISPRa
GA104566 1 Kit

Human SOX1 activation kit by CRISPRa

Sign In for Pricing
View Details
Pyridine-15N
TRC-P991282-50MG 50 mg

Pyridine-15N

Sign In for Pricing
View Details