Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus Gap junction beta-2 protein (GJB2)

This Recombinant Pongo pygmaeus Gap junction beta-2 protein (GJB2) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Gap junction beta-2 protein, Connexin-26, Cx26

UniProt

Q8MIT9

Expression Region

1-226

Origin

Pongo pygmaeus (Bornean orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDWGALQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGC KNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEE IKTQKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDGFSMQRLVKCNAWPCPNTVDC FVSRPTEKTVFTVFMIAVSGICILLNVTELCYLLIRYCSGRSKKPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Aminobenzoic Acid-d4
TRC-A591502-500MG 500 mg

4-Aminobenzoic Acid-d4

Sign In for Pricing
View Details
Amacr Mouse Gene Knockout Kit (CRISPR)
KN501178 1 Kit

Amacr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AZD-9291 Mesylate
TRC-A808205-25MG 25 mg

AZD-9291 Mesylate

Sign In for Pricing
View Details
Slc38a5 Mouse Gene Knockout Kit (CRISPR)
KN316095BN 1 Kit

Slc38a5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF384 (NM_001039917) Human Over-expression Lysate
LC421853 20 µg

ZNF384 (NM_001039917) Human Over-expression Lysate

Sign In for Pricing
View Details
MAD3 (MXD3) (NM_001142935) Human Over-expression Lysate
LY428302 100 µg

MAD3 (MXD3) (NM_001142935) Human Over-expression Lysate

Sign In for Pricing
View Details