Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Balaenoptera physalus ATP synthase subunit a (MT-ATP6)

This Recombinant Balaenoptera physalus ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P24945

Expression Region

1-226

Origin

Balaenoptera physalus (Finback whale) (Common rorqual)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNENLFAPFMIPVMLGIPITTLIIILPSMLFPAPNRLINNRTIAIQQWLTKLTSKQLMNV HSPKGQTWSLMLISLFLFIASTNLLGMLPHSFTPTTQLSMNVGMAIPLWAGTVTTGFRNK TKMSLAHLLPQGTPTFLIPMLVIIETISLFIQPVAWAVRLTANITAGHLLMHLIGETTLA LMNINLFSAFITFTILALLTILEFAVALIQAYVFTLLVSLYLHDNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDL Receptor (LDLR) (NM_000527) Human Recombinant Protein
TP720505 10 µg

LDL Receptor (LDLR) (NM_000527) Human Recombinant Protein

Sign In for Pricing
View Details
ketohexokinase (KHK) (NM_000221) Human Over-expression Lysate
LY400082 100 µg

ketohexokinase (KHK) (NM_000221) Human Over-expression Lysate

Sign In for Pricing
View Details
CDHR5 Polyclonal Antibody
E-AB-90700-01 60 µL

CDHR5 Polyclonal Antibody

Sign In for Pricing
View Details
CDHR5 Polyclonal Antibody
E-AB-90700-02 120 µL

CDHR5 Polyclonal Antibody

Sign In for Pricing
View Details
CDHR5 Polyclonal Antibody
E-AB-90700-03 200 µL

CDHR5 Polyclonal Antibody

Sign In for Pricing
View Details
Ipronidazole
TRC-I747000-10MG 10 mg

Ipronidazole

Sign In for Pricing
View Details