Recombinant Campylobacter fetus subsp. fetus ATP synthase subunit a (atpB)
This Recombinant Campylobacter fetus subsp. fetus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-226.
Product Specifications
Product Name Alternative
ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6
UniProt
A0RP13
Expression Region
1-226
Origin
Campylobacter fetus subsp. fetus (strain 82-40)
Field of Research
Immunology & Inflammation; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKELFLFSDMIMHSHTFNYLFHLILVAIIVLIVAKLATRSMQLVPRGSQNLLEAYLEGIV SMGRDVMGSDELARKYLPLVATIGLIVLTSNVIGIIPGFEAPSSSLNLTLCLALSVFLYY NFEGIRTQGIIKYFAHFMGPNKILAPLMFPIEIVSHLSRIVSLSFRLFGNIKGDDLFLMV VLSLAPWVAPLPAFALLTFMALLQTFIFMILTYVYLAGAVVVSEEH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740994-100 1x 100 µL
TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740806-100 1x 100 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940696-500 1x 500 µL
Cytokeratin 10/13 (DE-K13), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472221-100 1x 100 µL
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details