Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Molybdenum transport system permease protein modB (modB)

This Recombinant Molybdenum transport system permease protein modB (modB) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Molybdenum transport system permease protein modB

UniProt

P37731

Expression Region

1-226

Origin

Azotobacter vinelandii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPLSEHDLAAIRLTLELASLTTVLLLVVGTPIAWWLARTRSRLKGAIGAVVALPLVLPPT VLGFYLLVTMGPHGPIGQLTQFLGLGTLPFTFAGLVVASVFYSLPFVVQPLQNAFEAIGE RPLEVASTLRAGPWDTFFTVVVPLARPGFITAAILGFAHTVGEFGVVLMIGGNIPEKTRT VAVQIFDHVEAMEYAQAHWLAGGMVLFSFLVLFALYSSRRFKAGLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal MANF Antibody
APR06463G 0.1 mg

Polyclonal MANF Antibody

Sign In for Pricing
View Details
CtBP1 Polyclonal Antibody
ABP53884-01 30 µL

CtBP1 Polyclonal Antibody

Sign In for Pricing
View Details
CtBP1 Polyclonal Antibody
ABP53884-02 100 µL

CtBP1 Polyclonal Antibody

Sign In for Pricing
View Details
CtBP1 Polyclonal Antibody
ABP53884-03 200 µL

CtBP1 Polyclonal Antibody

Sign In for Pricing
View Details
HNRNPA1L2 antibody - N-terminal region
MBS3205120-01 0.1 mL

HNRNPA1L2 antibody - N-terminal region

Sign In for Pricing
View Details
HNRNPA1L2 antibody - N-terminal region
MBS3205120-02 5x 0.1 mL

HNRNPA1L2 antibody - N-terminal region

Sign In for Pricing
View Details