Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Choline transport system permease protein opuBD (opuBD)

This Recombinant Bacillus subtilis Choline transport system permease protein opuBD (opuBD) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Choline transport system permease protein opuBD

UniProt

P39775

Expression Region

1-226

Origin

Bacillus subtilis (strain 168)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLEQLMTYYAQNGSYVMDEFGRHFLMSAYGVLFAAVVGVPAGILIAHFRRLSAWVFAV TNVIQTIPALAMLAVLMLVMGLGANTVILSLFLYSLLPIIRNTYTGIISIEHAYLESGKA MGMTKFQVLRMVELPLALSVIMAGLRTALVIAIGITAIGTFVGAGGLGDMIVRGSNATNG TAIILAGAIPTAVMAVGADLLMAWLERALSPVKKKRTGAKHVQSAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydroxymethyl Polystyrene
H10000.5G 5 g

Hydroxymethyl Polystyrene

Sign In for Pricing
View Details
OTX2 Mouse Monoclonal Antibody [Clone ID: OTI1B2]
CF809509 100 µg

OTX2 Mouse Monoclonal Antibody [Clone ID: OTI1B2]

Sign In for Pricing
View Details
MSH6 Recombinant Mouse Monoclonal Antibody [A4C4-R]
HA601177 100 µL

MSH6 Recombinant Mouse Monoclonal Antibody [A4C4-R]

Sign In for Pricing
View Details
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2669), CF594 conjugate, 0.1mg/mL
BNC942669-500 1x 500 µL

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2669), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Wilms Tumor Protein Recombinant Rabbit monoclonal Antibody [SC06-41]
ET1610-45-50UL 50 µL

Wilms Tumor Protein Recombinant Rabbit monoclonal Antibody [SC06-41]

Sign In for Pricing
View Details
Human Sirtuin 3 (SIRT3) ELISA Kit
RD-SIRT3-Hu-01 96 Tests

Human Sirtuin 3 (SIRT3) ELISA Kit

Sign In for Pricing
View Details