Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lysosomal-associated transmembrane protein 4B (Laptm4b)

This Recombinant Rat Lysosomal-associated transmembrane protein 4B (Laptm4b) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Lysosomal-associated transmembrane protein 4B

UniProt

Q5U1W4

Expression Region

1-227

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKMVAPWTRFYSHSCCLCCHVRTGTILLGIWYLIINAVVLLILLSALADPDQYHFSGSEL GGEFEFMDDANMCIAIAISLLMILICAMATYGAYKQHAAWIIPFFCYQIFDFALNTLVAI TVLVYPNSIQEYIRQLPPSFPYRDDIMSVNPTCLVLVILLFIGIILTFKGYLISCVWSCY RYINGRNSSDVLVYVTSNDTTVLLPPYDDATAVTGTAKEPPPPYVSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYB561 (NM_001017916) Human Over-expression Lysate
LY422747 100 µg

CYB561 (NM_001017916) Human Over-expression Lysate

Sign In for Pricing
View Details
MDM2 (SMP14), CF740 conjugate, 0.1mg/mL
BNC741721-100 1x 100 µL

MDM2 (SMP14), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MEIS1 Mouse Monoclonal Antibody [Clone ID: OTI1B4]
CF809622 100 µg

MEIS1 Mouse Monoclonal Antibody [Clone ID: OTI1B4]

Sign In for Pricing
View Details
Glutathione S-Transferase Mu3 (GSTM3) (CPTC-GSTMu3-1), CF647 conjugate, 0.1mg/mL
BNC472243-500 1x 500 µL

Glutathione S-Transferase Mu3 (GSTM3) (CPTC-GSTMu3-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zinquin Ethyl Ester
#52020 1x 5 mg

Zinquin Ethyl Ester

Sign In for Pricing
View Details
FCAMR (NM_001122979) Human Over-expression Lysate
LC426592 20 µg

FCAMR (NM_001122979) Human Over-expression Lysate

Sign In for Pricing
View Details