Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lysosomal-associated transmembrane protein 4B (Laptm4b)

This Recombinant Mouse Lysosomal-associated transmembrane protein 4B (Laptm4b) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Lysosomal-associated transmembrane protein 4B

UniProt

Q91XQ6

Expression Region

1-227

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKMVAPWTRFYSHSCCLCCHVRTGTILLGVWYLIINAVVLLILLSALADPNQYHFSGSEL GGEFEFMDDANMCIAIAISLLMILICAMATYGAYKQHAAWIIPFFCYQIFDFALNTLVAI TVLVYPNSIQEYIRQLPPSFPYRDDIMSVNPTCLVLIILLFIGILLTLKGYLISCVWSCY RYINGRNSSDVLVYVTSNDTTVLLPPYDDATAVPSTAKEPPPPYVSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Copper Oxychloride
TRC-C685385-25G 25 g

Copper Oxychloride

Sign In for Pricing
View Details
Borrelia burgdorferi (p41 Flagellin) (6802), CF647 conjugate, 0.1mg/mL
BNC470144-500 1x 500 µL

Borrelia burgdorferi (p41 Flagellin) (6802), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (MLP/842), CF647 conjugate, 0.1mg/mL
BNC470842-500 1x 500 µL

MUC2 (MLP/842), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZFYVE19 (NM_001077268) Human Over-expression Lysate
LC421396 20 µg

ZFYVE19 (NM_001077268) Human Over-expression Lysate

Sign In for Pricing
View Details
Slc7a11 Mouse Gene Knockout Kit (CRISPR)
KN516188 1 Kit

Slc7a11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AS160 Recombinant Rabbit monoclonal Antibody
HA751385 100 µL

AS160 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details