Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lysosomal-associated transmembrane protein 4B (Laptm4b)

This Recombinant Mouse Lysosomal-associated transmembrane protein 4B (Laptm4b) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Lysosomal-associated transmembrane protein 4B

UniProt

Q91XQ6

Expression Region

1-227

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKMVAPWTRFYSHSCCLCCHVRTGTILLGVWYLIINAVVLLILLSALADPNQYHFSGSEL GGEFEFMDDANMCIAIAISLLMILICAMATYGAYKQHAAWIIPFFCYQIFDFALNTLVAI TVLVYPNSIQEYIRQLPPSFPYRDDIMSVNPTCLVLIILLFIGILLTLKGYLISCVWSCY RYINGRNSSDVLVYVTSNDTTVLLPPYDDATAVPSTAKEPPPPYVSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL10A Polyclonal Antibody
E-AB-19177-01 20 µL

RPL10A Polyclonal Antibody

Sign In for Pricing
View Details
RPL10A Polyclonal Antibody
E-AB-19177-02 60 µL

RPL10A Polyclonal Antibody

Sign In for Pricing
View Details
RPL10A Polyclonal Antibody
E-AB-19177-03 120 µL

RPL10A Polyclonal Antibody

Sign In for Pricing
View Details
RPL10A Polyclonal Antibody
E-AB-19177-04 200 µL

RPL10A Polyclonal Antibody

Sign In for Pricing
View Details
RNF113A (NM_006978) Human Recombinant Protein
TP304528 20 µg

RNF113A (NM_006978) Human Recombinant Protein

Sign In for Pricing
View Details
Lipoxygenase Microplate Assay Kit
RDSM220 100 Assays

Lipoxygenase Microplate Assay Kit

Sign In for Pricing
View Details