Recombinant Chlorocebus aethiops CD9 antigen (CD9)
This Recombinant Chlorocebus aethiops CD9 antigen (CD9) spans the amino acid sequence from region 2-228.
Product Specifications
Product Name Alternative
CD9 antigen, 27 kDa diphtheria toxin receptor-associated protein, DRAP27, CD_antigen= CD9
UniProt
P30409
Expression Region
2-228
Origin
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
PVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVY ILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEV QEFYKDTYNKLKTKDEPQRETLKAIHYALDCCGLAGGVEQFISDICPKKDVLETFTIKSC PDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
118004 1 Box (1 Roll x 1 Roll)
B30C-2250-581-WT Continuous Tapes for Printers
Sign In for Pricing
View Details 
E3452-45T-ML405 100 µL
ERK1, phosphorylated (Thr202/Tyr204) (Extracellular Signal-regulated Kinase 1, ERK-1, ERT2, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p44, Microtubule-associated Protein 2 Kinase, Mitogen-activated Protein Kinase 3, MAP Kinase 3, MAPK 3, MAPK3, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, P44ERK1, p44-ERK1, P44MAPK, p44-MAPK, PRKM3) (MaxLight 405) discontinued
Sign In for Pricing
View Details MBS6354638-01 0.2 mL
TDRD1, CT (TDRD1, Tudor domain-containing protein 1, Cancer/testis antigen 41.1) (Azide free) (HRP)
Sign In for Pricing
View Details MBS6354638-02 5x 0.2 mL
TDRD1, CT (TDRD1, Tudor domain-containing protein 1, Cancer/testis antigen 41.1) (Azide free) (HRP)
Sign In for Pricing
View Details 
GTR10357164 96 Well
Guinea Pig Cadherin related family member 1 (PCDH21) ELISA Kit
Sign In for Pricing
View Details