Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thioalkalivibrio sp. Electron transport complex protein RnfE (rnfE)

This Recombinant Thioalkalivibrio sp. Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

B8GMB9

Expression Region

1-228

Origin

Thioalkalivibrio sp. (strain HL-EbGR7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDISYREINANGFWHNNPGLVQLLGLCPLLAISGTVVNALGLGLATTLTLVASNVTVSL IRHWVRPEIRIPVFVLIIASVVTAIELAMNAFFHELYLILGIFIPLIVTNCAIIGRAEAF ASKQPIPKALADGLAMGLGFTCVLVALGALREAVGHGTLLADAHLMFGEAARGFSLTLFE EYRGFLLALLPPGAFIALGLLIALKNIIDARLQKRQPAQAAVPVEAAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin D1 Antibody (CCND1)
F48111-0.4ML 0.4 mL

Cyclin D1 Antibody (CCND1)

Sign In for Pricing
View Details
2-(2-Thienyl)pyrrolidine
TRC-T344360-50MG 50 mg

2-(2-Thienyl)pyrrolidine

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS803641 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Cytokeratin 18 (DE-K18), 1mg/mL
BNUM0563-50 1x 50 µL

Cytokeratin 18 (DE-K18), 1mg/mL

Sign In for Pricing
View Details
Carboxy Polystyrene
H10008.100G 100 g

Carboxy Polystyrene

Sign In for Pricing
View Details
MYO1E (N-term) Rabbit Polyclonal Antibody
AP52795PU-N 400 µL

MYO1E (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details