Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thioalkalivibrio sp. Electron transport complex protein RnfE (rnfE)

This Recombinant Thioalkalivibrio sp. Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

B8GMB9

Expression Region

1-228

Origin

Thioalkalivibrio sp. (strain HL-EbGR7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDISYREINANGFWHNNPGLVQLLGLCPLLAISGTVVNALGLGLATTLTLVASNVTVSL IRHWVRPEIRIPVFVLIIASVVTAIELAMNAFFHELYLILGIFIPLIVTNCAIIGRAEAF ASKQPIPKALADGLAMGLGFTCVLVALGALREAVGHGTLLADAHLMFGEAARGFSLTLFE EYRGFLLALLPPGAFIALGLLIALKNIIDARLQKRQPAQAAVPVEAAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARSB (NM_198709) Human Recombinant Protein
TP306565M 100 µg

ARSB (NM_198709) Human Recombinant Protein

Sign In for Pricing
View Details
5HT1E Receptor (HTR1E) (NM_000865) Human Over-expression Lysate
LC424479 20 µg

5HT1E Receptor (HTR1E) (NM_000865) Human Over-expression Lysate

Sign In for Pricing
View Details
SNF2H (SMARCA5) (NM_003601) Human Recombinant Protein
TP303775 20 µg

SNF2H (SMARCA5) (NM_003601) Human Recombinant Protein

Sign In for Pricing
View Details
Tuba1c Mouse Gene Knockout Kit (CRISPR)
KN518460 1 Kit

Tuba1c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glycine
TRC-G615990-10MG 10 mg

Glycine

Sign In for Pricing
View Details
Alphameprodine Hydrochloride
TRC-M224950-10MG 10 mg

Alphameprodine Hydrochloride

Sign In for Pricing
View Details