Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thioalkalivibrio sp. Electron transport complex protein RnfE (rnfE)

This Recombinant Thioalkalivibrio sp. Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

B8GMB9

Expression Region

1-228

Origin

Thioalkalivibrio sp. (strain HL-EbGR7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDISYREINANGFWHNNPGLVQLLGLCPLLAISGTVVNALGLGLATTLTLVASNVTVSL IRHWVRPEIRIPVFVLIIASVVTAIELAMNAFFHELYLILGIFIPLIVTNCAIIGRAEAF ASKQPIPKALADGLAMGLGFTCVLVALGALREAVGHGTLLADAHLMFGEAARGFSLTLFE EYRGFLLALLPPGAFIALGLLIALKNIIDARLQKRQPAQAAVPVEAAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJB14 (NM_001031723) Human Over-expression Lysate
LY422173 100 µg

DNAJB14 (NM_001031723) Human Over-expression Lysate

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF594 conjugate, 0.1mg/mL
BNC942059-500 1x 500 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NDE1 Human Gene Knockout Kit (CRISPR)
KN400179 1 Kit

NDE1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS630944 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
MUC2 (MLP/842), CF740 conjugate, 0.1mg/mL
BNC740842-100 1x 100 µL

MUC2 (MLP/842), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
9-cis-Retinol
TRC-R252095-50MG 50 mg

9-cis-Retinol

Sign In for Pricing
View Details