Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Claudin-10 (CLDN10)

This Recombinant Pongo abelii Claudin-10 (CLDN10) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Claudin-10

UniProt

Q5R8E5

Expression Region

1-228

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGV SNCKDFPSMLALDGYIQACRGLMIAAVSLGSFGSIFALFGMKCTKVGGSDKAKAKIACLA GIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFC FSISDNNKTPRYAYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC37 sgRNA CRISPR Lentivector (Human) (Target 2)
K2550803 1.0 µg DNA

TTC37 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
PLA2G7 Rabbit pAb
E47R1451 100 µL

PLA2G7 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Escherichia coli Uncharacterized protein ygeH (ygeH)
MBS1086009-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Uncharacterized protein ygeH (ygeH)

Sign In for Pricing
View Details
Recombinant Escherichia coli Uncharacterized protein ygeH (ygeH)
MBS1086009-02 0.02 mg (Yeast)

Recombinant Escherichia coli Uncharacterized protein ygeH (ygeH)

Sign In for Pricing
View Details
Recombinant Escherichia coli Uncharacterized protein ygeH (ygeH)
MBS1086009-03 0.1 mg (E-Coli)

Recombinant Escherichia coli Uncharacterized protein ygeH (ygeH)

Sign In for Pricing
View Details
Recombinant Escherichia coli Uncharacterized protein ygeH (ygeH)
MBS1086009-04 0.1 mg (Yeast)

Recombinant Escherichia coli Uncharacterized protein ygeH (ygeH)

Sign In for Pricing
View Details