Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Derlin-3 (Derl3)

This Recombinant Mouse Derlin-3 (Derl3) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Derlin-3, Degradation in endoplasmic reticulum protein 3, Der1-like protein 3, Protein IZP6

UniProt

Q9D8K3

Expression Region

1-228

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGQRLAAGFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITT FLFFGPLGFGFFFNMLFVFRYCRMLEEGSFRGRKADFVFMFLFGGVLMTLLGFLGSLFFL GQALMAMLVYVWSRRSPHVRVNFFGLLNFQAPFLPWALMGFSLLLGNSVVTDLLGILVGH IYYFLEDVFPNQPGGKRLLLTPSVLKLLLDDPQEDPDYLPLPEEQPEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BOK Antibody, Biotin conjugated
CSB-PA892353LD01HU-01 50 µg

BOK Antibody, Biotin conjugated

Sign In for Pricing
View Details
BOK Antibody, Biotin conjugated
CSB-PA892353LD01HU-02 100 µg

BOK Antibody, Biotin conjugated

Sign In for Pricing
View Details
Recombinant Human CD34 Protein, C-Fc
AP95381 50 µg

Recombinant Human CD34 Protein, C-Fc

Sign In for Pricing
View Details
Human Lysine Specific Demethylase 4B (KDM4B) ELISA Kit
YP-W100223-01 48 Tests

Human Lysine Specific Demethylase 4B (KDM4B) ELISA Kit

Sign In for Pricing
View Details
Human Lysine Specific Demethylase 4B (KDM4B) ELISA Kit
YP-W100223-02 96 Tests

Human Lysine Specific Demethylase 4B (KDM4B) ELISA Kit

Sign In for Pricing
View Details
Kallikrein 7 (KLK7) (NM_005046) Human Tagged ORF Clone Lentiviral Particle
RC204423L4V 200 µL

Kallikrein 7 (KLK7) (NM_005046) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details