Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Derlin-3 (Derl3)

This Recombinant Mouse Derlin-3 (Derl3) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Derlin-3, Degradation in endoplasmic reticulum protein 3, Der1-like protein 3, Protein IZP6

UniProt

Q9D8K3

Expression Region

1-228

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGQRLAAGFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITT FLFFGPLGFGFFFNMLFVFRYCRMLEEGSFRGRKADFVFMFLFGGVLMTLLGFLGSLFFL GQALMAMLVYVWSRRSPHVRVNFFGLLNFQAPFLPWALMGFSLLLGNSVVTDLLGILVGH IYYFLEDVFPNQPGGKRLLLTPSVLKLLLDDPQEDPDYLPLPEEQPEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEK kinase-3 siRNA (m)
sc-156010 10 µM

MEK kinase-3 siRNA (m)

Sign In for Pricing
View Details
2-(2-Hydroxyethyl) pyridine
MBS3600186-01 5 mg

2-(2-Hydroxyethyl) pyridine

Sign In for Pricing
View Details
2-(2-Hydroxyethyl) pyridine
MBS3600186-02 10 mg

2-(2-Hydroxyethyl) pyridine

Sign In for Pricing
View Details
2-(2-Hydroxyethyl) pyridine
MBS3600186-03 25 mg

2-(2-Hydroxyethyl) pyridine

Sign In for Pricing
View Details
2-(2-Hydroxyethyl) pyridine
MBS3600186-04 50 mg

2-(2-Hydroxyethyl) pyridine

Sign In for Pricing
View Details
2-(2-Hydroxyethyl) pyridine
MBS3600186-05 100 mg

2-(2-Hydroxyethyl) pyridine

Sign In for Pricing
View Details