Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-15 (CLDN15)

This Recombinant Human Claudin-15 (CLDN15) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Claudin-15

UniProt

P56746

Expression Region

1-228

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVY NCWEFPSMLALSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA GALHILAGICGMVAISWYAFNITRDFFDPLYPGTKYELGPALYLGWSASLISILGGLCLC SACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zscan12 Mouse Gene Knockout Kit (CRISPR)
KN520147 1 Kit

Zscan12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Di-O-benzoyl-D-tartaric Acid
TRC-D417325-250G 250 g

Di-O-benzoyl-D-tartaric Acid

Sign In for Pricing
View Details
TentaGel® MB CHO
MB160006.25G 25 g

TentaGel® MB CHO

Sign In for Pricing
View Details
Aldo-keto Reductase Family 1 Member C2 / DD2 (CPTC-AKR1C2-1), CF405S conjugate, 0.1mg/mL
BNC042255-500 1x 500 µL

Aldo-keto Reductase Family 1 Member C2 / DD2 (CPTC-AKR1C2-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AKAP12 Polyclonal Antibody
E-AB-12884-01 20 µL

AKAP12 Polyclonal Antibody

Sign In for Pricing
View Details
AKAP12 Polyclonal Antibody
E-AB-12884-02 60 µL

AKAP12 Polyclonal Antibody

Sign In for Pricing
View Details