Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chloroplast envelope membrane protein (cemA)

This Recombinant Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

P58155

Expression Region

1-229

Origin

Lotus japonicus

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKKKASIPFLSLTSIVFLPWCISFTCKKGMEYWVTNWWNTKQSEIFLNIIQEKSILKKF MELEELFFLDELLKEYSETRLQILRTGIHKETIQLIKTHNEDRIYTILHFSTNIIYFIIL SGYSILGNQELIILNSWVQEFLYNLSDTIKAFSILLVTDLCIGFHSTHGWELLIGSVYKD FGFIQNDQIISGLVSTFPVILDTILKYWIFRYLNRVSPSLVVIYHSMND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXC9 Rabbit Polyclonal Antibody
E10G12743 100 µL

HOXC9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAFAH1B2 (NM_002572) Human Recombinant Protein
TP301313M 100 µg

PAFAH1B2 (NM_002572) Human Recombinant Protein

Sign In for Pricing
View Details
Feline leukemia virus Real Time PCR Detection kit
BSL23S1 16 Tests

Feline leukemia virus Real Time PCR Detection kit

Sign In for Pricing
View Details
hsa-miR-590-5p miRNA Antagomir
MNH03184 2x 5.0 nmol

hsa-miR-590-5p miRNA Antagomir

Sign In for Pricing
View Details
Cinnamic acid (b)
orb1220816-01 200 mg

Cinnamic acid (b)

Sign In for Pricing
View Details
Cinnamic acid (b)
orb1220816-02 500 mg

Cinnamic acid (b)

Sign In for Pricing
View Details