Recombinant Aethionema cordifolium Chloroplast envelope membrane protein (cemA)
This Recombinant Aethionema cordifolium Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-229.
Product Specifications
Product Name Alternative
Chloroplast envelope membrane protein
UniProt
A4QJC7
Expression Region
1-229
Origin
Aethionema cordifolium (Lebanon stonecress)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAKKKAFIPFLYFTSIVFFPWWISLCCNKSLKTWITNWWNTRQRETFLNEIQEKSLLEKF IQLEELFQLDEMIKEYPETDLQKFRLGIHKETIQFIKIHNEYRIHTIFNFSTNLISFVIL SSYSFWGKEKLFILNSWVQEFLYNLSDTIKAFLILLLTDLCIGFHSPHGWELMIGYIYKD FGFAHYEQLLSGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHAIND
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681775-100 1x 100 µL
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741239-500 1x 500 µL
Napsin-A (NAPSA/1239), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401908-500 1x 500 µL
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details