Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Glycine betaine/carnitine/choline transport system permease protein OpuCD (opuCD)

This Recombinant Bacillus subtilis Glycine betaine/carnitine/choline transport system permease protein OpuCD (opuCD) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Glycine betaine/carnitine/choline transport system permease protein OpuCD

UniProt

O34742

Expression Region

1-229

Origin

Bacillus subtilis (strain 168)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVLQQLGTYYSQNGGYVLQEFYRHFLMSVYGVLFAAIVGIPLGILIARYRRLSGWVFAV TNVIQTIPALAMLAVLMLVMGLGANTVILSLFLYSLLPIIRNTYTGIISIEHAYLESGKA MGMTKFQVLRMVELPLALSVIMAGLRTALVIAIGITAIGTFVGAGGLGDIIVRGSNATNG TAIILAGAIPTALMAVIADLVMGWLERALSPIKKKKGNFIIADRKTTSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-500 1x 500 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL
BNC680026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-500 1x 500 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-500 1x 500 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
BNC881073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details