Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vitis vinifera Chloroplast envelope membrane protein (cemA)

This Recombinant Vitis vinifera Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q0ZJ08

Expression Region

1-229

Origin

Vitis vinifera (Grape)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKKKAFTPLLYLASIVFLPWWISLSLNKSLESWVTNWWNTRQSETFLNDIQEKSILEKF IELEELFLLDEMIKECPETHLQKLRMGIHKETIQLIKMYNEDPIHTILHFSTNIICFVIL SGYSILGNEELLILNSWIQQFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGSVYKD FGFAHNDQIISGLVSTFPVILDTILKYWIFRYLNRVSPSLVVIYHSMND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCFC1R1 Knockout 143B Polyclonal Cells
ARG35674 1 Million

HCFC1R1 Knockout 143B Polyclonal Cells

Sign In for Pricing
View Details
OAAF06599-100UG - MAP3KL4 Antibody
OAAF06599-100UG 100 µg

OAAF06599-100UG - MAP3KL4 Antibody

Sign In for Pricing
View Details
TUBB4B ORF Vector (Human) (pORF)
48816011 1.0 µg DNA

TUBB4B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PLAT siRNA (Human)
CRH3567-01 15 nmol

PLAT siRNA (Human)

Sign In for Pricing
View Details
PLAT siRNA (Human)
CRH3567-02 30 nmol

PLAT siRNA (Human)

Sign In for Pricing
View Details
LGALS3BP (NM_005567) Human Untagged Clone
SC128088 10 µg

LGALS3BP (NM_005567) Human Untagged Clone

Sign In for Pricing
View Details