Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative ABC transporter permease protein ORF1

This Recombinant Putative ABC transporter permease protein ORF1 spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Putative ABC transporter permease protein ORF1

UniProt

Q53683

Expression Region

1-229

Origin

Streptomyces antibioticus

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IPRHPTLANVRQAFAEQPLAHAALNSLLVALATAAVTVLIATPMAYVMARHRTKAARAAT GWVVVSQAFPFVLLIIPLFLVLKRLRLIDSLTGLVLVYVVWSLPFALWMLAGHARAVPAE LEEAAAVDGAGRVRTLTSVTVPLLAPGIAATALFAFVTAWNEFFFALVLLKSPHRQTLPV VLTHFIGAEGVPTSPAGAAAFLATLPSLAFFALVQRRITSGLLTGAVKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Alpha-defensin-related sequence 12 (Defa-rs12), partial
MBS1169925-01 0.05 mg (E-Coli)

Recombinant Mouse Alpha-defensin-related sequence 12 (Defa-rs12), partial

Sign In for Pricing
View Details
Recombinant Mouse Alpha-defensin-related sequence 12 (Defa-rs12), partial
MBS1169925-02 0.2 mg (E-Coli)

Recombinant Mouse Alpha-defensin-related sequence 12 (Defa-rs12), partial

Sign In for Pricing
View Details
Recombinant Mouse Alpha-defensin-related sequence 12 (Defa-rs12), partial
MBS1169925-03 0.5 mg (E-Coli)

Recombinant Mouse Alpha-defensin-related sequence 12 (Defa-rs12), partial

Sign In for Pricing
View Details
Recombinant Mouse Alpha-defensin-related sequence 12 (Defa-rs12), partial
MBS1169925-04 0.05 mg (Baculovirus)

Recombinant Mouse Alpha-defensin-related sequence 12 (Defa-rs12), partial

Sign In for Pricing
View Details
Recombinant Mouse Alpha-defensin-related sequence 12 (Defa-rs12), partial
MBS1169925-05 0.2 mg (Yeast)

Recombinant Mouse Alpha-defensin-related sequence 12 (Defa-rs12), partial

Sign In for Pricing
View Details
Recombinant Mouse Alpha-defensin-related sequence 12 (Defa-rs12), partial
MBS1169925-06 1 mg (E-Coli)

Recombinant Mouse Alpha-defensin-related sequence 12 (Defa-rs12), partial

Sign In for Pricing
View Details