Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secretory carrier-associated membrane protein 4 (SCAMP4)

This Recombinant Human Secretory carrier-associated membrane protein 4 (SCAMP4) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Secretory carrier-associated membrane protein 4, Secretory carrier membrane protein 4

UniProt

Q969E2

Expression Region

1-229

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEKENNFPPLPKFIPVKPCFYQNFSDEIPVEHQVLVKRIYRLWMFYCATLGVNLIACLA WWIGGGSGTNFGLAFVWLLLFTPCGYVCWFRPVYKAFRADSSFNFMAFFFIFGAQFVLTV IQAIGFSGWGACGWLSAIGFFQYSPGAAVVMLLPAIMFSVSAAMMAIAIMKVHRIYRGAG GSFQKAQTEWNTGTWRNPPSREAQYNNFSGNSLPEYPTVPSYPGSGQWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF594 conjugate, 0.1mg/mL
BNC940189-500 1x 500 µL

CD74 (BU45), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF405S conjugate, 0.1mg/mL
BNC042345-500 1x 500 µL

CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10/13 (DE-K13), CF640R conjugate, 0.1mg/mL
BNC400696-500 1x 500 µL

Cytokeratin 10/13 (DE-K13), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATG5 (Autophagy Marker) (ATG5/2101), CF640R conjugate, 0.1mg/mL
BNC402101-500 1x 500 µL

ATG5 (Autophagy Marker) (ATG5/2101), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (2755-8), CF594 conjugate, 0.1mg/mL
BNC940091-100 1x 100 µL

Fibronectin (2755-8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF594 conjugate, 0.1mg/mL
BNC942344-500 1x 500 µL

CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details