Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spinacia oleracea Chloroplast envelope membrane protein (cemA)

This Recombinant Spinacia oleracea Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q9M3L4

Expression Region

1-229

Origin

Spinacia oleracea (Spinach)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKKKVFIPFLYLISIVFLPWWIYLSFQKSLESWVTTWWNTKQSETFLNDIQEKKLLEKF IELEELRLLDEMIKEYPETQLQKLGIGIHNETIQLIKMHNEDCIHMILHFSTNLICFLIL GGYSILGNKELILLNSWVQEFLYNLSDTIKAFSILLVTDLCIGFHSPQGWELLIESIYKD FGFADNDQIISSLVSTFPVILDTILKYWIFRSLNRVSPSLVVIYHSMND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LKB1 (STK11) Human Gene Knockout Kit (CRISPR)
KN402885 1 Kit

LKB1 (STK11) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EZH2 Rabbit Polyclonal Antibody
TA368948 100 µL

EZH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-Anthracenecarboxylic Acid
TRC-A637258-50MG 50 mg

1-Anthracenecarboxylic Acid

Sign In for Pricing
View Details
Slc29a4 (C-term) Rabbit Polyclonal Antibody
AP11120PU-N 400 µL

Slc29a4 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Perfluoro(butylcyclohexane)
TRC-P999370-500MG 500 mg

Perfluoro(butylcyclohexane)

Sign In for Pricing
View Details
BCMO1 (BCO1) Human Gene Knockout Kit (CRISPR)
KN423790 1 Kit

BCMO1 (BCO1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details