Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spinacia oleracea Chloroplast envelope membrane protein (cemA)

This Recombinant Spinacia oleracea Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q9M3L4

Expression Region

1-229

Origin

Spinacia oleracea (Spinach)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKKKVFIPFLYLISIVFLPWWIYLSFQKSLESWVTTWWNTKQSETFLNDIQEKKLLEKF IELEELRLLDEMIKEYPETQLQKLGIGIHNETIQLIKMHNEDCIHMILHFSTNLICFLIL GGYSILGNKELILLNSWVQEFLYNLSDTIKAFSILLVTDLCIGFHSPQGWELLIESIYKD FGFADNDQIISSLVSTFPVILDTILKYWIFRSLNRVSPSLVVIYHSMND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HINT1 Polyclonal Antibody
E-AB-13291-01 20 µL

HINT1 Polyclonal Antibody

Sign In for Pricing
View Details
HINT1 Polyclonal Antibody
E-AB-13291-02 60 µL

HINT1 Polyclonal Antibody

Sign In for Pricing
View Details
HINT1 Polyclonal Antibody
E-AB-13291-03 120 µL

HINT1 Polyclonal Antibody

Sign In for Pricing
View Details
HINT1 Polyclonal Antibody
E-AB-13291-04 200 µL

HINT1 Polyclonal Antibody

Sign In for Pricing
View Details
SEPHS1 Polyclonal Antibody
E-AB-53184-01 20 µL

SEPHS1 Polyclonal Antibody

Sign In for Pricing
View Details
SEPHS1 Polyclonal Antibody
E-AB-53184-02 60 µL

SEPHS1 Polyclonal Antibody

Sign In for Pricing
View Details