Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium Electron transport complex protein RnfE (rnfE)

This Recombinant Salmonella typhimurium Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

P65540

Expression Region

1-230

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Metastasis, unknown source
CB629903 1 Block

Frozen Tissue Blocks, Metastasis, unknown source

Sign In for Pricing
View Details
Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF488A conjugate, 0.1mg/mL
BNC882130-500 1x 500 µL

Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tylvalosin (>90%)
TRC-T898211-1MG 1 mg

Tylvalosin (>90%)

Sign In for Pricing
View Details
Ldoc1 (NM_001018087) Mouse Tagged ORF Clone
MG201078 10 µg

Ldoc1 (NM_001018087) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Coumachlor-d4
TRC-C745002-5MG 5 mg

Coumachlor-d4

Sign In for Pricing
View Details
MRPL13 (C-term) Rabbit Polyclonal Antibody
AP33215PU-N 50 µL

MRPL13 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details