Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 221 (Tmem221)

This Recombinant Mouse Transmembrane protein 221 (Tmem221) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Transmembrane protein 221

UniProt

Q8K071

Expression Region

1-230

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRSYGGRVLAAMTLLGIPAAVLVALAAQLLFQLQAGRAELRRVRTDGLHPELDPDAGLP EAAAGALLPLATALAALAQVLGLSCLLLAALCGHLGAELARGPGPGRSDWFLYDCRLLRH SALGLFCCGVSVYLAALAIYALLLFEIEAGAAAASILGSGALILVAIMTHTLFRAVQATR RGLRELSPPSFEDEPARPSEDSKSGCRAQPPQDEETETPIGAVTHQGSHF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP2R1B Rabbit Polyclonal Antibody
AP05041PU-N 100 µg

PPP2R1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EPHB1/2/3 Antibody
8C15651-AAT 50 µg

EPHB1/2/3 Antibody

Sign In for Pricing
View Details
Amplite® Fluorimetric Malondialdehyde (MDA) Quantitation Kit
10071-AAT 200 Tests

Amplite® Fluorimetric Malondialdehyde (MDA) Quantitation Kit

Sign In for Pricing
View Details
Atg5 Mouse Gene Knockout Kit (CRISPR)
KN301740 1 Kit

Atg5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD40 Antibody[G28.5]
E-AB-F1214J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD40 Antibody[G28.5]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD40 Antibody[G28.5]
E-AB-F1214J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD40 Antibody[G28.5]

Sign In for Pricing
View Details