Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Claudin-2 (CLDN2)

This Recombinant Bovine Claudin-2 (CLDN2) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Claudin-2

UniProt

Q765P1

Expression Region

1-230

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASLGLQLVGYVLGLLGLLGTVIAMLLPSWRTSSYVGASIVTAVGFSKGLWMECATHSTG ITQCDIYSTMLGLPADIQAAQAMMVTSSAMSSLACIVSVVGMRCTVFFQESRAKDRVAVV GGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIF LCFSCSPQGNRSNYYDAYQAQPLATRSSPRPGQAPKGKSEFNSYSLTGYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dyrk3 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6244804 1.0 µg DNA

Dyrk3 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Rac-3-octadecanamido-2-methoxypropan-1-ol phosphocholine
288797-01 1 mg

Rac-3-octadecanamido-2-methoxypropan-1-ol phosphocholine

Sign In for Pricing
View Details
Rac-3-octadecanamido-2-methoxypropan-1-ol phosphocholine
288797-02 2 mg

Rac-3-octadecanamido-2-methoxypropan-1-ol phosphocholine

Sign In for Pricing
View Details
Rac-3-octadecanamido-2-methoxypropan-1-ol phosphocholine
288797-03 5 mg

Rac-3-octadecanamido-2-methoxypropan-1-ol phosphocholine

Sign In for Pricing
View Details
Rac-3-octadecanamido-2-methoxypropan-1-ol phosphocholine
288797-04 10 mg

Rac-3-octadecanamido-2-methoxypropan-1-ol phosphocholine

Sign In for Pricing
View Details
IRAK4 Protein Vector (Human) (pPM-C-HA)
25075021 500 ng

IRAK4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details