Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio vulnificus Electron transport complex protein RnfE (rnfE)

This Recombinant Vibrio vulnificus Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

Q7MM86

Expression Region

1-230

Origin

Vibrio vulnificus (strain YJ016)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEHKKLLKNGMWDNNPALVQLLGLCPLLAVSSTVTNALGLGIATLLVLVGSNVTVSLIR NYVPKEIRIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAYAS KNDPLPAALDGFWMGMGMTTVLVVLGAMREIIGNGTLFDGADLLLGEWASALRIQVFQFD SSFLLALLPPGAFIGVGLLIALKNVIDTQLKARQPKQEKPAIERARVTNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

tert-Dodecanethiol
TRC-T204763-5G 5 g

tert-Dodecanethiol

Sign In for Pricing
View Details
TIMP1 Polyclonal Antibody
D-AB-10195L-01 25 µL

TIMP1 Polyclonal Antibody

Sign In for Pricing
View Details
TIMP1 Polyclonal Antibody
D-AB-10195L-02 100 µL

TIMP1 Polyclonal Antibody

Sign In for Pricing
View Details
NUMBL Mouse Monoclonal Antibody [Clone ID: OTI6H7]
CF812190 100 µg

NUMBL Mouse Monoclonal Antibody [Clone ID: OTI6H7]

Sign In for Pricing
View Details
STAT5B (STAT5B/2611), 0.2mg/mL
BNUB2611-500 1x 500 µL

STAT5B (STAT5B/2611), 0.2mg/mL

Sign In for Pricing
View Details
TRAPPC3 Antibody
8C19146-AAT 50 µg

TRAPPC3 Antibody

Sign In for Pricing
View Details