Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 221 (TMEM221)

This Recombinant Human Transmembrane protein 221 (TMEM221) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Transmembrane protein 221

UniProt

A6NGB7

Expression Region

1-230

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARSYGGRVLAAMTLLGIAAAVLAALGAQLLFQLQAGRAELRGLRAEGLGQELGAGPGLP EDAAGTLLPLAAALAALVLVLGFTCLLLAALCGHLGAELARGPGPRRSDWFLYDCRLLRH VALGLFCCGISVYLAALSIYALLLFEIETGAAAASILGSGTLVLVAVLTHTLLRAARAAR RGLHELSPPSFEDDLARPAEVSKASPRAQPQQGIHRRTPYSTCPEPGDPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD14/CD45, 8G3/B-A11; IgG1 / IgG1; FITC / PE
M873033050 1 Unit

CD14/CD45, 8G3/B-A11; IgG1 / IgG1; FITC / PE

Sign In for Pricing
View Details
RAB5A Polyclonal Antibody
E-AB-15485-01 20 µL

RAB5A Polyclonal Antibody

Sign In for Pricing
View Details
RAB5A Polyclonal Antibody
E-AB-15485-02 60 µL

RAB5A Polyclonal Antibody

Sign In for Pricing
View Details
RAB5A Polyclonal Antibody
E-AB-15485-03 120 µL

RAB5A Polyclonal Antibody

Sign In for Pricing
View Details
RAB5A Polyclonal Antibody
E-AB-15485-04 200 µL

RAB5A Polyclonal Antibody

Sign In for Pricing
View Details
Cbl discontinued
398803-01 50 µL

Cbl discontinued

Sign In for Pricing
View Details