Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa Chloroplast envelope membrane protein (cemA)

This Recombinant Oryza sativa Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

P0C302

Expression Region

1-230

Origin

Oryza sativa (Rice)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKKKALPSFLYLVFIVLLPWGVSFSFNKCLELWIKNWWNTRQSQTLLTAIQEKRVLERF MELEDLFILDEMIKEKPNTHVQNPPIGIRKEIIQLAKIDNEGHLHIILHFSTNIICLAIL SGSFFLGKEELVILNSWVQEFFYNLNDSVKAFFILLVTDFFVGFHSTRGWELLIRWVYND LGWVPNELIFTIFVCSFPVILDTCLKFWVFFCLNRLSPSLVVIYHSISEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Bromo-2,5-dichlorophenol
TRC-B687920-5G 5 g

4-Bromo-2,5-dichlorophenol

Sign In for Pricing
View Details
Human CBSL activation kit by CRISPRa
GA119581 1 Kit

Human CBSL activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant SEC14L2 Antibody
RC-16585-01 50 μL

Recombinant SEC14L2 Antibody

Sign In for Pricing
View Details
Recombinant SEC14L2 Antibody
RC-16585-02 100 µL

Recombinant SEC14L2 Antibody

Sign In for Pricing
View Details
Recombinant SEC14L2 Antibody
RC-16585-03 1 mL

Recombinant SEC14L2 Antibody

Sign In for Pricing
View Details
Recombinant Human LRAP/ERAP2 Protein (His Tag)
PKSH031454 50 µg

Recombinant Human LRAP/ERAP2 Protein (His Tag)

Sign In for Pricing
View Details