Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium Protein MgtC (mgtC)

This Recombinant Salmonella typhimurium Protein MgtC (mgtC) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Protein MgtC

UniProt

D0ZLQ7

Expression Region

1-231

Origin

Salmonella typhimurium (strain 14028s / SGSC 2262)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEERMLMFPYILNLLAAMLLGALIGAERQWRQRMAGLRTNALVATGAAVFILSSMTTSPD SPGRIAAQIVSGIGFLGAGVIMREGMNVRGLNTAATLWCSAGIGVLCGLGQFKNALAATI IILCANILLREAAQRINQLPISAEGEKRYILKVTCNKEDESAVRQWLLNIVKEAAICLQG LGSVPAQEQGYKEIRAELVGHADYRKTRELIISRIGDNDNITAIHWSIDSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-100 1x 100 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF594 conjugate, 0.1mg/mL
BNC940012-500 1x 500 µL

Tyrosinase (T311), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
BNC681073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-500 1x 500 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details