Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Morus indica Chloroplast envelope membrane protein (cemA)

This Recombinant Morus indica Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q09X05

Expression Region

1-231

Origin

Morus indica (Mulberry)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKKKAFISLLYLASIVFLPWWISLSFTFNKSLESWVNNWWNTRPSEILLNDIQEKSILK KFIELEELSLFDEMLKEYSERRLQKLHVGVYNETIQWIKMHNEGRIHTILHFSTNIISFV ILSVFSILSNEELIFLNSCLQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGSIY KDFGFAHNDQIISGVVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSMND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Resazurin Cell Viability Assay Kit (2500 assays)
#30025-1 1 Kit

Resazurin Cell Viability Assay Kit (2500 assays)

Sign In for Pricing
View Details
PD-L1 (CD274) (NM_014143) Human Recombinant Protein
TP710226 20 µg

PD-L1 (CD274) (NM_014143) Human Recombinant Protein

Sign In for Pricing
View Details
Crhbp Mouse Gene Knockout Kit (CRISPR)
KN503822 1 Kit

Crhbp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Calnexin (Endoplasmic Reticulum Marker) (CANX/1543), CF647 conjugate, 0.1mg/mL
BNC471543-100 1x 100 µL

Calnexin (Endoplasmic Reticulum Marker) (CANX/1543), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NOSTRIN (NM_001039724) Human Recombinant Protein
TP310661 20 µg

NOSTRIN (NM_001039724) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant MBD2 Antibody
RC-6993-01 50 μL

Recombinant MBD2 Antibody

Sign In for Pricing
View Details