Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Post-GPI attachment to proteins factor 2 (pgap2)

This Recombinant Danio rerio Post-GPI attachment to proteins factor 2 (pgap2) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 2, FGF receptor-activating protein 1

UniProt

Q5BL33

Expression Region

1-231

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQVPYGSVDRDKPLIRVPFTRLAVITVCLPLLGLVACIVLAMLYHYNDATYTHCQVPNY LPSISAAISLTPERYIWRFSIGLHSAPRFLVAAAYLSFYRGRFSRRLTEQLLSGFTFLLA LSENVGLLLLTYVSSTETYSVHKSGFILFIGSSLFHMLCTCKLWSLIVKYSISSEEMMSY WFKLRLFLFNGGCCVLAVYFYRRHNTYCEEGITHASRCVSIWWCCPTWPST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sumo 1 (SUMO1) Rabbit Monoclonal Antibody
TA422336 100 µL

Sumo 1 (SUMO1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
APRT Human Gene Knockout Kit (CRISPR)
KN416874 1 Kit

APRT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Flutriafol
TRC-F599700-1G 1 g

Flutriafol

Sign In for Pricing
View Details
ING -2 TMA+ Salt - yellow -green fluorescent sodium indicator
2013F 10x 50 µg

ING -2 TMA+ Salt - yellow -green fluorescent sodium indicator

Sign In for Pricing
View Details
Human Inhibin A (INHA) ELISA Kit
RDR-INHA-Hu-01 96 Tests

Human Inhibin A (INHA) ELISA Kit

Sign In for Pricing
View Details
Human Inhibin A (INHA) ELISA Kit
RDR-INHA-Hu-02 48 Tests

Human Inhibin A (INHA) ELISA Kit

Sign In for Pricing
View Details