Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Post-GPI attachment to proteins factor 2 (pgap2)

This Recombinant Danio rerio Post-GPI attachment to proteins factor 2 (pgap2) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 2, FGF receptor-activating protein 1

UniProt

Q5BL33

Expression Region

1-231

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQVPYGSVDRDKPLIRVPFTRLAVITVCLPLLGLVACIVLAMLYHYNDATYTHCQVPNY LPSISAAISLTPERYIWRFSIGLHSAPRFLVAAAYLSFYRGRFSRRLTEQLLSGFTFLLA LSENVGLLLLTYVSSTETYSVHKSGFILFIGSSLFHMLCTCKLWSLIVKYSISSEEMMSY WFKLRLFLFNGGCCVLAVYFYRRHNTYCEEGITHASRCVSIWWCCPTWPST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GW 7647
TRC-G931603-25MG 25 mg

GW 7647

Sign In for Pricing
View Details
p-Toluidine Hydrochloride
TRC-T536240-5G 5 g

p-Toluidine Hydrochloride

Sign In for Pricing
View Details
Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF405S Conjugate, 0.1 mg/mL
BNC041331-1ML 1x 1 mL

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF405S Conjugate, 0.1 mg/mL

Sign In for Pricing
View Details
NEU2 (NM_005383) Human Over-expression Lysate
LY401652 100 µg

NEU2 (NM_005383) Human Over-expression Lysate

Sign In for Pricing
View Details
(R)-2-Phenyl-2-pivalamidoacetic Acid
TRC-P336320-50MG 50 mg

(R)-2-Phenyl-2-pivalamidoacetic Acid

Sign In for Pricing
View Details
Pidotimod Diketopiperazine-6-propanoic Acid
TRC-P747870-50MG 50 mg

Pidotimod Diketopiperazine-6-propanoic Acid

Sign In for Pricing
View Details