Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Electron transport complex protein RnfE (rnfE)

This Recombinant Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

Q8FH92

Expression Region

1-231

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDEKMKKRRTEAVAERALPNGETGNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tlcd1 Mouse Gene Knockout Kit (CRISPR)
KN517606 1 Kit

Tlcd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Wdr53 activation kit by CRISPRa
GA208005 1 Kit

Mouse Wdr53 activation kit by CRISPRa

Sign In for Pricing
View Details
Malaria Pf/Pv Ab Combo Rapid Test
R0111C 30 Cassettes

Malaria Pf/Pv Ab Combo Rapid Test

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS704076 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Human MUC20 activation kit by CRISPRa
GA116372 1 Kit

Human MUC20 activation kit by CRISPRa

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF488A conjugate, 0.1mg/mL
BNC882309-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details