Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Uncharacterized protein Cj0236c (Cj0236c)

This Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Uncharacterized protein Cj0236c (Cj0236c) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Uncharacterized protein Cj0236c

UniProt

Q9PIQ8

Expression Region

1-231

Origin

Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLYDRDYSRSKEFENTRSSELSIFIKQTYQLFAASLLAATVGAYVGIFALASFFIQSQV TFWILFAVEIGLLFALQWKKREAPLNLVLLFGFTFCSGLTLTPLLISVLALPAGGIIIAQ AFALTTVAFAGLSVFAMNTKKDFTVMGKALFIVLIVIVAASLLNLFFQSSIVNLAISAVA AILFSFYILYDTQNIIRGNYETPIEGAVALYLDFVNLFVSLLNILRSFNSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Prostate
CB524046 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS701583 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Caspase-6 (CASP6) (NM_001226) Human Over-expression Lysate
LY400490 100 µg

Caspase-6 (CASP6) (NM_001226) Human Over-expression Lysate

Sign In for Pricing
View Details
BCL2L15 (NM_001010922) Human Over-expression Lysate
LY423230 100 µg

BCL2L15 (NM_001010922) Human Over-expression Lysate

Sign In for Pricing
View Details
Upadacitinib-D2,15N
TRC-U800077-25MG 25 mg

Upadacitinib-D2,15N

Sign In for Pricing
View Details
Ly6g Polyclonal Antibody
E-AB-70094-01 60 µL

Ly6g Polyclonal Antibody

Sign In for Pricing
View Details