Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yvbI (yvbI)

This Recombinant Bacillus subtilis Uncharacterized protein yvbI (yvbI) spans the amino acid sequence from region 1-232.

Product Specifications

Product Name Alternative

Uncharacterized protein yvbI

UniProt

O32246

Expression Region

1-232

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCPQCGHQTDGGNFCEKCGSPLPGQSGHQHAAQTGAAAKQAAKQFGSFVLSVLKRPYQE CKATGGEQLISAIITMVLFSLLTPLMFYILFSDGPGSVSFTAIFLEPTIYFILFLFGLHA CIFFALKIAGNQVSFKDSFSRFGAFLIPFTAILILALFFFLLHTDICFTILAVGLIGAFF AIPPAMLSSYQHSYKGKVDFIYSTIVIYLIICVTFQLIIEHYVKEIFRYMLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPS2 (Center) Rabbit Polyclonal Antibody
AP53456PU-N 400 µL

PRPS2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HSPC014 (POMP) (NM_015932) Human Over-expression Lysate
LC402471 20 µg

HSPC014 (POMP) (NM_015932) Human Over-expression Lysate

Sign In for Pricing
View Details
(-)-a-Cedrene (major, contains (+)-b-cedrene)
TRC-C364863-25G 25 g

(-)-a-Cedrene (major, contains (+)-b-cedrene)

Sign In for Pricing
View Details
GFP Rabbit Polyclonal Antibody
AP54983SU-N 200 µL

GFP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC30A2 Antibody
8C19618-AAT 50 µg

SLC30A2 Antibody

Sign In for Pricing
View Details
SUOX (NM_000456) Human Over-expression Lysate
LY424706 100 µg

SUOX (NM_000456) Human Over-expression Lysate

Sign In for Pricing
View Details