Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Clarin-1 (Clrn1)

This Recombinant Mouse Clarin-1 (Clrn1) spans the amino acid sequence from region 1-232.

Product Specifications

Product Name Alternative

Clarin-1, Usher syndrome type-3 protein homolog

UniProt

Q8K445

Expression Region

1-232

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSQQKKIIFCMAGVLSFLCALGVVTAVGTPLWVKATILCKTGALLVNASGKELDKFMGE MQYGLFHGEGVRQCGLGARPFRFSFFPDLVQAIPVSIHINIILFSMILVVLTMVGTAFFM YNAFGKPFETLHGPLGLYLVSFISGSCGCLVMILFASEVKVHRLSEKIANFKEGTYAYRT QNENYTTSFWVVFICFFVHFLNGLLIRLAGFQFPFTKSKETETTNVASDLMY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CALML3 shRNA (UAS) - Lentiviral human CALML3 shRNA (UAS, GFP) plasmid
GTR15316357 1 Vial

Lentiviral human CALML3 shRNA (UAS) - Lentiviral human CALML3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Barrier-to-autointegration Factor (BANF1) Mouse ELISA Kit
B7998 96 Tests

Barrier-to-autointegration Factor (BANF1) Mouse ELISA Kit

Sign In for Pricing
View Details
GPR123 Polyclonal Antibody
JOT-AP03687-01 20 µL

GPR123 Polyclonal Antibody

Sign In for Pricing
View Details
GPR123 Polyclonal Antibody
JOT-AP03687-02 50 μL

GPR123 Polyclonal Antibody

Sign In for Pricing
View Details
GPR123 Polyclonal Antibody
JOT-AP03687-03 100 µL

GPR123 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CD1.1 antigen Antibody (CB3) [DyLight 680]
NBP1-28362FR 0.1 mL

Mouse Monoclonal CD1.1 antigen Antibody (CB3) [DyLight 680]

Sign In for Pricing
View Details