Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella oneidensis Electron transport complex protein RnfE (rnfE)

This Recombinant Shewanella oneidensis Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-232.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

Q8EE76

Expression Region

1-232

Origin

Shewanella oneidensis (strain MR-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNYREIAWQGLWKNNPGLVQRLGLCPLLAVTTTLTNALGLGIATMLVLIGSNVLISLVR DYVPKEIRIPVFVMIIAALVTAVQLLVNAYAYGLYMSLGIFLPLIVTNCIIIGRAEAFAS RNNAFSSAFDGLMMGLGFTLVLVLLGATREILGQGTLFDGADQLLGPWAKALTFQVWQVD TSFLLAMLPPGAFIVMGLLIALKNVIDKKLRERQPETAVQPSVARARITKVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NL-W75-8 Die-cut & Printed Numbers & Letters
234261 800 Pack (32 Label (s) x 25 Card)

NL-W75-8 Die-cut & Printed Numbers & Letters

Sign In for Pricing
View Details
Mouse anti CytokeRatin 18 / KeRatin K18
MBS570181-01 0.1 mg

Mouse anti CytokeRatin 18 / KeRatin K18

Sign In for Pricing
View Details
Mouse anti CytokeRatin 18 / KeRatin K18
MBS570181-02 5x 0.1 mg

Mouse anti CytokeRatin 18 / KeRatin K18

Sign In for Pricing
View Details
VAC14 Antibody (C-term)
orb1926998-01 50 µL

VAC14 Antibody (C-term)

Sign In for Pricing
View Details
VAC14 Antibody (C-term)
orb1926998-02 100 µL

VAC14 Antibody (C-term)

Sign In for Pricing
View Details
Lentiviral mouse Zfp493 shRNA (UAS) - Lentiviral mouse Zfp493 shRNA (UAS, RFP) plasmid
GTR15274645 1 Vial

Lentiviral mouse Zfp493 shRNA (UAS) - Lentiviral mouse Zfp493 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details