Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Clarin-1 (CLRN1)

This Recombinant Human Clarin-1 (CLRN1) spans the amino acid sequence from region 1-232aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Usher syndrome type-3 protein

UniProt

P58418

Expression Region

1-232aa

Tag

N-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.7 kDa

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSQQKKIIFCMAGVFSFACALGVVTALGTPLWIKATVLCKTGALLVNASGQELDKFMGEMQYGLFHGEGVRQCGLGARPFRFSFFPDLLKAIPVSIHVNVILFSAILIVLTMVGTAFFMYNAFGKPFETLHGPLGLYLLSFISGSCGCLVMILFASEVKIHHLSEKIANYKEGTYVYKTQSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADLMY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CST9L Protein Vector (Rat) (pPM-C-HA)
PV262132 500 ng

CST9L Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
NOC3L Protein Vector (Rat) (pPM-C-His)
PV285569 500 ng

NOC3L Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Ethyl[1- (oxolan-2-yl) -2-phenylethyl]amine, phosphoric acid
LUD67971-01 50 mg

Ethyl[1- (oxolan-2-yl) -2-phenylethyl]amine, phosphoric acid

Sign In for Pricing
View Details
Ethyl[1- (oxolan-2-yl) -2-phenylethyl]amine, phosphoric acid
LUD67971-02 0.5 g

Ethyl[1- (oxolan-2-yl) -2-phenylethyl]amine, phosphoric acid

Sign In for Pricing
View Details
ATF2, Control Peptide (Cyclic AMP-dependent Transcription Factor ATF-2, cAMP-dependent Transcription Factor ATF-2, Activating Transcription Factor 2, cAMP Response Element-binding Protein CRE-BP1, HB16, Cyclic AMP-responsive Element-binding Protein 2, cAMP-responsive Element-binding Protein 2, CREB-2, CREB2, CREBP1, MGC111558)
147419 100 µg

ATF2, Control Peptide (Cyclic AMP-dependent Transcription Factor ATF-2, cAMP-dependent Transcription Factor ATF-2, Activating Transcription Factor 2, cAMP Response Element-binding Protein CRE-BP1, HB16, Cyclic AMP-responsive Element-binding Protein 2, cAMP-responsive Element-binding Protein 2, CREB-2, CREB2, CREBP1, MGC111558)

Sign In for Pricing
View Details
Rat Cytochrome P45019A1 (CYP19A1) ELISA Kit
YP-W36797-01 48 Tests

Rat Cytochrome P45019A1 (CYP19A1) ELISA Kit

Sign In for Pricing
View Details