Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit a 2 (atpB2)

This Recombinant Synechococcus sp. ATP synthase subunit a 2 (atpB2) spans the amino acid sequence from region 1-233.

Product Specifications

Product Name Alternative

ATP synthase subunit a 2, ATP synthase F0 sector subunit a 2, F-ATPase subunit 6 2

UniProt

B1XRK3

Expression Region

1-233

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQITPDNIIFYQYQFVVINATLVYTWLTMALLVIGAAWVTKKLVVRPKLPPWQNFLEIVV DGIYQHIAEVTQQEPEPYLAFVGTLFLFILTANLLTVVPGYQAPTGSLSTTTALAIAVFI AVPIYGIRQRGILGYLKSYLQPTPIMLPFQIIGEFSRTLALAVRLFGNIMSGNLLAAILL ALVPLFVPVAMNLLGLVFGVIQAYVFAILALVYIASAATVQEKKQSISMEENS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL 17 Human
OM296706-01 25 µg

IL 17 Human

Sign In for Pricing
View Details
IL 17 Human
OM296706-02 5 µg

IL 17 Human

Sign In for Pricing
View Details
IL 17 Human
OM296706-03 1 mg

IL 17 Human

Sign In for Pricing
View Details
Ethyl 2-Oxopentanoate
TRC-E925805-2.5G 2.5 g

Ethyl 2-Oxopentanoate

Sign In for Pricing
View Details
Tide Quencher™ 2 azide [TQ2 azide]
2211-AAT 5 mg

Tide Quencher™ 2 azide [TQ2 azide]

Sign In for Pricing
View Details
Sambucus nigra -SNA-II- Immobilized Lectin
A-6803-2 2 mL

Sambucus nigra -SNA-II- Immobilized Lectin

Sign In for Pricing
View Details