Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit a 2 (atpB2)

This Recombinant Synechococcus sp. ATP synthase subunit a 2 (atpB2) spans the amino acid sequence from region 1-233.

Product Specifications

Product Name Alternative

ATP synthase subunit a 2, ATP synthase F0 sector subunit a 2, F-ATPase subunit 6 2

UniProt

B1XRK3

Expression Region

1-233

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQITPDNIIFYQYQFVVINATLVYTWLTMALLVIGAAWVTKKLVVRPKLPPWQNFLEIVV DGIYQHIAEVTQQEPEPYLAFVGTLFLFILTANLLTVVPGYQAPTGSLSTTTALAIAVFI AVPIYGIRQRGILGYLKSYLQPTPIMLPFQIIGEFSRTLALAVRLFGNIMSGNLLAAILL ALVPLFVPVAMNLLGLVFGVIQAYVFAILALVYIASAATVQEKKQSISMEENS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (4,4-Dimethylcyclohexyl) -4,4-dimethylcyclohexan-1-amine
LTB38503-01 50 mg

N- (4,4-Dimethylcyclohexyl) -4,4-dimethylcyclohexan-1-amine

Sign In for Pricing
View Details
N- (4,4-Dimethylcyclohexyl) -4,4-dimethylcyclohexan-1-amine
LTB38503-02 0.5 g

N- (4,4-Dimethylcyclohexyl) -4,4-dimethylcyclohexan-1-amine

Sign In for Pricing
View Details
Haao-1 Antibody
orb799206 2 mg

Haao-1 Antibody

Sign In for Pricing
View Details
LOC100359537 3'UTR Luciferase Stable Cell Line
TU207224 1.0 mL

LOC100359537 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
IFIT1 Recombinant Protein (Rat)
RP205514 100 µg

IFIT1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Mouse RING finger protein 17, RNF17 ELISA Kit
MBS9340588-01 48 Well

Mouse RING finger protein 17, RNF17 ELISA Kit

Sign In for Pricing
View Details