Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis Protein YIPF6 (yipf6)

This Recombinant Xenopus tropicalis Protein YIPF6 (yipf6) spans the amino acid sequence from region 1-233.

Product Specifications

Product Name Alternative

Protein YIPF6, YIP1 family member 6

UniProt

Q28CH8

Expression Region

1-233

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAETEGFGDSGSKQLFAGLSNVSISGDIPVEGEITVPMASTSQEDDLSTLDEPVKDTIMR DLKAVGNKFLHVMYPKKSTTLLRDWDLWGPLVLCVSLALMLQGGNADSKDDGGPQFAEVF VIIWFGAVVITLNSKLLGGTISFFQSLCVLGYCILPLTVAMLVCRLVLLLSHTTASFIVR LVVVTVMFAWSTFASTAFLADSQPPNRRALAVYPIFLFYFVISWMVLTFNTVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QuantiChrom™ Peroxide Assay Kit II
D2OX-100 100 Tests

QuantiChrom™ Peroxide Assay Kit II

Sign In for Pricing
View Details
MEIS1 Rabbit Polyclonal Antibody
TA367131 100 µL

MEIS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant p57 Kip2 Antibody
RC-5851-01 50 μL

Recombinant p57 Kip2 Antibody

Sign In for Pricing
View Details
Recombinant p57 Kip2 Antibody
RC-5851-02 100 µL

Recombinant p57 Kip2 Antibody

Sign In for Pricing
View Details
Recombinant p57 Kip2 Antibody
RC-5851-03 1 mL

Recombinant p57 Kip2 Antibody

Sign In for Pricing
View Details
ONECUT3 (NM_001080488) Human Over-expression Lysate
LC421043 20 µg

ONECUT3 (NM_001080488) Human Over-expression Lysate

Sign In for Pricing
View Details