Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Lysosomal-associated transmembrane protein 4A (LAPTM4A)

This Recombinant Pongo abelii Lysosomal-associated transmembrane protein 4A (LAPTM4A) spans the amino acid sequence from region 1-233.

Product Specifications

Product Name Alternative

Lysosomal-associated transmembrane protein 4A

UniProt

Q5RAH0

Expression Region

1-233

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSMSFKRNRSDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMAILLTVEVTHPNSMPAV NIQYEVIGNYYSSERMADNACVLFAVSVLMFIISSMLVYGAISYQVGWLIPFFCYRLFDF VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFALFIIFKAYLI NCVWNCYKYINNRNVPEIAVYPAFEAPPQYVLPTYEMAVKMPEKEPPPPYLPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(4-Bromo-2-chlorophenyl)ethyl Iodide
TRC-B682240-25MG 25 mg

2-(4-Bromo-2-chlorophenyl)ethyl Iodide

Sign In for Pricing
View Details
Mouse Tmem59 activation kit by CRISPRa
GA205931 1 Kit

Mouse Tmem59 activation kit by CRISPRa

Sign In for Pricing
View Details
CD11b / MAC-1 (Microglial Marker) (ITGAM/3339), CF647 conjugate, 0.1mg/mL
BNC473339-500 1x 500 µL

CD11b / MAC-1 (Microglial Marker) (ITGAM/3339), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gelsolin / Actin-depolymerizing Factor (CPTC-Gelsolin-1), CF647 conjugate, 0.1mg/mL
BNC472239-500 1x 500 µL

Gelsolin / Actin-depolymerizing Factor (CPTC-Gelsolin-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4, Mouse (T-Cell Marker) (GK1.5), CF568 conjugate, 0.1mg/mL
BNC682009-100 1x 100 µL

CD4, Mouse (T-Cell Marker) (GK1.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GTPBP3 (NM_001128855) Human Over-expression Lysate
LY427012 100 µg

GTPBP3 (NM_001128855) Human Over-expression Lysate

Sign In for Pricing
View Details